Pay in 4 interest-free payments of $37.45 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
Immunogen: Recombinant fusion protein of human KIAA0513(NP_001273494
pdf LD652 Lymantria dispar Biontex_Insectogene_Protocol_LD652
SLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHY
Bioworld Molecular Weight: 19 kD Note: For research use only
namely experimental autoimmune encephalomyelitis (EAE)
Recombinant Mouse TIM-3/HAVCR2 Protein (aa 20-191, His Tag) - PKSM041276 Size:50μg Immunogen: Recombinant fusion protein ofRecombinant Mouse TIM 3 HAVCR2 Protein (aa 20 191, His Tag) Size: 50g Catalogue Number: PKSM041276 50 Citations, Manuals and MSDS Available upon request. Abbreviation: TIM 3; HAVCR2 Target Synonym: Hepatitis A virus cellular receptor 2 homolog; HAVcr 2; T cell immunoglobulin and mucin domain containing protein 3; T cell immunoglobulin mucin receptor 3; T cell membrane protein 3; Tim3; Timd3 UNIProt ID: Q8VIM0 Target Species: Mouse Expression Host: